SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005423 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005423
Domain Number 1 Region: 133-205
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000496
Family Splicing factor U2AF subunits 0.0033
Further Details:      
 
Weak hits

Sequence:  PYU1_T005423
Domain Number - Region: 206-228
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000419
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number - Region: 72-96
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000785
Family CCCH zinc finger 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005423
Sequence length 331
Comment protein Name="PYU1_T005423" Note="Similar to U2AF35A: Splicing factor U2af small subunit A (Oryza sativa subsp. japonica)" AED:0.112451361867704 QI:0|-1|0|1|-1|1|1|0|331
Sequence
MSSRYGGGGDEFRGRGRDRSRDRGYGNYNGRGYNRGGGDRMMGRRGGGGGGEQSGGGAEH
LARIHGTEEDRVNCPFYFKIGACRHGDRCSRLHNKPVFSQTILVSHMYQNPISQIIAQNG
DPSTIDQKQVDEDFEDFYEEVFEELCKFGRLEELNICDNLGDHLVGNMYAKFEDEECAAA
AQKSLYGRFYAGRPLVCEFSPVTDFREARCRQFDEGTCNRGGYCNFMHIKTVPRSMQREL
ERMFNRPHNRDKSRSRSRSRSRSKGRKSKGRSRSPSRSRSGSRDRKGSSRRRSASRSRSR
SPSPRKSRRSRSRSRSASPAPAKDPADVKKE
Download sequence
Identical sequences K3WKD1
PYU1_T005423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]