SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005427 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005427
Domain Number 1 Region: 232-312
Classification Level Classification E-value
Superfamily PUG domain-like 1.01e-19
Family PUG domain 0.0026
Further Details:      
 
Domain Number 2 Region: 438-541
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.41e-16
Family UBX domain 0.021
Further Details:      
 
Domain Number 3 Region: 8-62
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000121
Family UBX domain 0.011
Further Details:      
 
Weak hits

Sequence:  PYU1_T005427
Domain Number - Region: 72-140
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000161
Family UBX domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005427
Sequence length 576
Comment protein Name="PYU1_T005427" Note="Similar to ASPSCR1: Tether containing UBX domain for GLUT4 (Homo sapiens)" AED:0.0945789041888994 QI:0|0.42|0.25|0.75|1|1|8|0|576
Sequence
MALNIEFNGQSKRFQVLEDARGQFTLTDAMQYQLLHRNRVVDLSIPFRLTGISNNAVLEI
QELASGAKEALPQQVRVCVQMTDGKRVQSSFGNDATIESILVFFKLLPSTLDREILADAF
ASTNLKELGIVSGSAIFRVQASQSKAPASASPIAEPARAQAAQVASNVSAPGPKEEEKPR
APVVPAQSAPPAAPVQAPQSAFVNDGDEEMKESSVLEDAFAPVKKLGSYEALQLLRDNCF
DATARGAIPTLMKIVTNILSYPDNEKMRSIRVSNAAFQRSVGSLKGGIEFLESVGFTLDQ
ETQCLVLKSAADTKSQLEEGLRLLNNEADDLNIEESKIPVVVVPRAADPDFDVYKPQITR
MQAQPRGPSVTEVLVDNLKSKQDQLVGHEKPPRNTSVTLPGRQSAASFIPSAASTMDVDM
DEGEHPSDSRILISTLKAKRAEMEKAKNFRTQAMRELDELKKKKVFQTTLIRVQFPDRVV
LQAAFHPNETVQDVVDHVRESLQQAFSGNQFYLYITPPTQKLDPRKTLAELNLVPAALTY
LSWIDALPSLEQSASGFYLRDELVRVTKLRWNIVMQ
Download sequence
Identical sequences K3WKD5
PYU1_T005427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]