SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005441 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005441
Domain Number 1 Region: 149-213
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000144
Family Ubiquitin-related 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005441
Sequence length 1101
Comment protein Name="PYU1_T005441" Note="Similar to Nup107: Nuclear pore complex protein Nup107 (Mus musculus)" AED:0.0449183303085299 QI:0|-1|0|1|-1|1|1|0|1101
Sequence
MATRDGSTTQRLIEGADETLNFLVNSIPDLQDAQTSRFALSGACATDRSSVNAVYSGSEG
LSAMSSDTFYFNSSAASSAASQSIFSSARGIDTAPPSGSLSNFDDAQEETMDDALMPSSV
VDLSVRKGFLHVKGVFPDHSAEYIDIDPRFMTIGELKRAFCAKRETHKDLGFDARGAKIM
FDGQLVEDDWLVVDCGMGLDGVIHIVKAFTGGFLTGARSDHLELRVNAQPVDPKLPISSI
ASVYARQNAPNEASMLSLATTFQLSSSQAETLSRHVRPEEANFAEIASDFYEHLENVQNT
DLYCENLLKGYIDVLQTRLEHLEATAQGKYASTRQRLREDIQELRDERNTWRLLYELRQI
CHTDDVEDENDDTLMLGAEGGEELHFDMLEDDAIRLLETRNENFKIQSVVKTWLETIALE
KTVAISEKRGTSGSRTLKLMKKNLINKEEVVHLDPDAMLREGDEFILEDDAEDEAELMKS
VWLFIRAGKISDAVDLCIRLGQSWRAASLSGGTPLGASESSERKDMALDRWGNPFRALWK
TTCWKFSEHKDLNLTKGNNLLAREYEEIIYAALSGNVEVIAKSRLCETWEDHIWAYLRAM
TEQQQDEILYKLLKVKTQSSQLVVGNNAHYLRHYINLLEKTKYLKRYQANLDTLFEELKG
SRIESVRAQANQPHRHIQAKLVTAKVEYIVSNILDIMLFNPDDDSYNWDLQLNSRVQADE
LSPLFLRFAAHFILFSLFTGEKFDEQAGHMILKLYIRHLVKHRQLQLVPVYASRLPYPGA
VEIYVQVLATVEDTLEREMVVKRILQYSDMEVLSTVLQISVDRMCEEYRQTSEDQKQASF
ASTSVATSAIDVRRMRTIEYLCFYNEHRAEALCRANILARQFVKEGKFSALHQLFAEIVP
EDSVGIVNLHRGIQTKDDHEIDLCIRELLCWKTYIRACTHYDSWRNCVGNAVSWTLYSEE
KEFLTELMYHVSRATTGLLEALHFENGWLMQCSEVEGDDTVIRQLCLPLLVFNLHYMQLE
SARIIMRLSFYPEDAKLQLARPLMEKSLEVADVVADEHYGVYNALSQNECRDLLHGIRES
SIALVYTEPSPPSSSTTEDAN
Download sequence
Identical sequences K3WKE9
PYU1_T005441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]