SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005454 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005454
Domain Number 1 Region: 30-239
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.14e-23
Family Lysophospholipase 0.045
Further Details:      
 
Weak hits

Sequence:  PYU1_T005454
Domain Number - Region: 333-403
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0488
Family Bacteriorhodopsin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005454
Sequence length 438
Comment protein Name="PYU1_T005454" Note="Similar to Pnpla3: Patatin-like phospholipase domain-containing protein 3 (Mus musculus)" AED:0.110478359908884 QI:0|-1|0|1|-1|1|1|0|438
Sequence
MASSPIIEVVAGQRGTLAATLMAPPSVAMPTGFSFACGGWLKMYLFGVAKALQEFELERD
AQMIGCSAGALTATALAMKCDFDAIRDYVLTNVIPKAHATFDGPFKVREYLRDTLAATGK
LHRYEMLNEKKPLTIVYTSLSAWASRRITEFTSRDHLEKSLLASCCAPPIAGMPFKMNGE
WVMDGGLFDFQPTFDGKTVTVSPFYCTGADIKPSRYVPMWWAVLPPGERDVEWLFDLGYE
DGLTWIVKSGLAGSKHVEIPTKGASYDGEWTTTVGRVLGYRGVESRVLDAMFVGLFVCLW
KPLVFLLLYLELYLHVLIAGGKAAVFGAAAKLMMSSIVIALSVVMLATLSLQDTLLFFVG
LIASGIFLGVLVLLCGGIHEAARVASQDWQKCQSCLRNITSLSLFLRSVPVYGASVQLKR
HEFLLKHSFVYRVTLHFV
Download sequence
Identical sequences K3WKG2
PYU1_T005454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]