SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005480 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005480
Domain Number 1 Region: 11-110
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000054
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005480
Sequence length 114
Comment protein Name="SPEF1" Note="flagellar associated protein" AED:0.438827556543245 QI:0|0.5|0.33|0.66|1|1|3|0|114
Sequence
MPMEHLPLDDETLQRLYAWIDEIPLSRPKKSIARDFSDGILSAEVVAFYFPKLVQMHNYS
PANSVKQKLYNWNTLNRKVFKKLHIFLSKDDIDDLVQCRPGAVEHLLVKLQLKI
Download sequence
Identical sequences K3WKI8
PYU1_T005480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]