SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005526 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005526
Domain Number 1 Region: 11-133
Classification Level Classification E-value
Superfamily NTF2-like 2.24e-30
Family NTF2-like 0.0027
Further Details:      
 
Domain Number 2 Region: 362-473
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.5e-21
Family Canonical RBD 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005526
Sequence length 536
Comment protein Name="PYU1_T005526" Note="Similar to nxt3: Putative G3BP-like protein (Schizosaccharomyces pombe)" AED:0.0923129647751531 QI:0|0|0|0.5|1|1|2|0|536
Sequence
MTSAAEENYHPSIVGNTFMRQYYQLLAKEPQSLHRFYKDESRWSHTTGSQMQEPIAGQKA
INEQILKRGYAGARVDLDIGSIDCQASLDGGVFVLVTGVMTLVDSIVPKPFVQTFFLAVQ
PKGYFVLNDCLRFLELPGASPASIASATDAPVVATPAAPASVVKEVKKTQAAIGTPVAQS
PAAKAAPKPPSPVKAAAPAASTPVVPKEKAPASPAAAPASPVKSKTPVTQSPVETTGAPK
SAPRDASPVKKTAPAVEKKSEETAPAAVASPKAAATAAPLSPVKAQPAAPAPVPAAPSSW
AALFTATQVVSAIASPPAAPASTNAAKAAAPAPVSATAAPAKQAPAATTVSPKAAGKAND
TGAPKEKTRYFSLYIKEVPAQTKDSDVRELFKSYGSIANVNVIASRGYAFVDYYEEGSMR
AALAEGNEFKLFDKTLSVDERTDRKEQRGGFRNDTRGGRGGGRGPKGGRTGGDRKERGDE
QFKEPRRTGENGSAANGSSFSSGGRGGTNGSGPRSDRRDKGGRRGGKVDSSSARTE
Download sequence
Identical sequences K3WKN4
PYU1_T005526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]