SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005532 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005532
Domain Number 1 Region: 610-744,774-962
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.53e-75
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.000049
Further Details:      
 
Domain Number 2 Region: 249-502
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000128
Family Rhodopsin-like 0.019
Further Details:      
 
Weak hits

Sequence:  PYU1_T005532
Domain Number - Region: 748-771
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.0746
Family HSP33 redox switch-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005532
Sequence length 987
Comment protein Name="PYU1_T005532" Note="Similar to PIP5K8: Phosphatidylinositol-4-phosphate 5-kinase 8 (Arabidopsis thaliana)" AED:0.0838662075750123 QI:0|1|0.57|1|1|1|7|0|987
Sequence
MNGRASAYTDRDSTRSSDGVIERHPVHLPHERSFGRTPGRGPAPPPPLGPPPIPFEVSST
TSSSSSSLPGFQDQSPVRRPPTTRGGKPNGSSGLHLPMADSLSSTKNKPSPVNAPTTFTS
SMLSGGIPATGTGNGQGASTGPGGSYTSMQTPIETKKKSPAMPLDLQVGRDRLDDSSEDS
YDNGSYLSEKIPGGPNGDGDGWFHAKIKVDSSIQWANNYKIQLFMFLMLVGGVVVTLVFA
NNSAEASVGLFCGSIITLISCSSVVYTFLTRPTWRKHPNPIIFFRSLCDIGLVSVLLMTE
LYKCGTGKCRATLGDASCSATAALTQFFLWSSESWFFVMAIDMLFSLQSPFTDYKRNVRR
YHLFVWLTAMTTAIILVSIPDFAGPSEFGYCWTDSKSKLRNNKPDITEGENYLWKLNFQS
WALFYIWLILFWCYAIIVIYWAYKRLHSGLSETLRMRLRVLHSVTIYVIAIIIYWAFTFF
VYVPYLIQTKKTKEVTQMMNFMITCKGYFDFAVWFQMNEFHENLSKGDAKKTDIDVDVDL
SPQVNIALRCEVLYYTTTGIIQAVRDTQHLPPGANQQELYLQPQGTEENRASLGVDEYMI
RTRPKAALSKGTLFIDYCPHTFQTIREHFGVDTNQYIESLSRTTKERLSEGASGAFMFFS
HDQQLIVKSMSDEESAFLRSIAPEYASFLLTNPDSLLTRFYGCHAIRLYGKTFNFVVMAN
LFSTDKIIHRRYDIKGSWVNRSAKHPSKGKRVTCRHCNAKYVFGSTDAENCPAQVGRHEP
NVVLKDNDLTARVRLDPKVAEELYDQLVKDANFLSRLGIMDYSLLLGVHNVEYMVNPDLA
EEMEESVPALGGLQGKNRNSTQTDLTHRSGKGRASNPTANSPPRTKQRAGLPRLGTGTRR
ANTVVGPSIYYFGLIDILQQWTMEKKMERFAKTKLLGKDTDGLSALPPTAYCDRFKRKMG
EILSVTIRNEYDEIYDERRSDGHRRFM
Download sequence
Identical sequences K3WKP0
PYU1_T005532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]