SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005558 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005558
Domain Number 1 Region: 140-277
Classification Level Classification E-value
Superfamily Cyclin-like 3.06e-45
Family Cyclin 0.0000471
Further Details:      
 
Domain Number 2 Region: 279-402
Classification Level Classification E-value
Superfamily Cyclin-like 8.06e-30
Family Cyclin 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005558
Sequence length 408
Comment protein Name="PYU1_T005558" Note="Similar to CYCB1-1: Cyclin-B1-1 (Arabidopsis thaliana)" AED:0.0787545787545787 QI:0|0.5|0.33|1|1|1|3|153|408
Sequence
MPSLVNNENEVPQHANRPAKAFNVLNDIGKAEKRPRGLKPQTATTTTRRAVLGDVTNKLG
GVKRTAAMAMQKKPLAKRTTQTTITSKLVETTPVSNTFGTMGIKEGTTPVVRSAEKLQEI
VDLASDEEEENHDIDSDDKNNASACWQYAEDITKYQLEDEKKRKPSASYMSRQSDINSKM
RAILVDWLVDVHCKYDLLPQTLHIAIHLIDQYLEKDMSVPRQKLQLVGVTALFIASKYEE
IYPPEADDFVRITDNAYTRDELFRMEEDLLASIQYRVTFPTKYQFVKRFLKASRTSDDRV
EHFAHYVIDRSLQEYKLIKYLPSTVAASAVHIARTQMRDLPAWSSTLEYHSSYAEHALTD
CVEDLKEMLWNAQNGVGKTSKLTAVRRKFSKERFMGVSSHPLVFDESS
Download sequence
Identical sequences K3WKR6
PYU1_T005558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]