SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005584 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005584
Domain Number 1 Region: 242-364,399-584
Classification Level Classification E-value
Superfamily DNase I-like 6e-38
Family Sphingomyelin phosphodiesterase-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005584
Sequence length 595
Comment protein Name="PYU1_T005584" Note="Similar to CCR4-2: Carbon catabolite repressor protein 4 homolog 2 (Arabidopsis thaliana)" AED:0.0666351606805293 QI:0|0.85|0.75|1|1|1|8|46|595
Sequence
MKKGYLSPSSKGRRQVLSVSPPKGSPVHGEGKISLRVDQPVEGCQVMTHAFFRSVDGDID
DKDVDLQFHWYRSSMRRACANSECPRHGEGNVLLLVAKLECVLCCRLGITREHSCFCSPD
CFRLAWHKHKQLHDNMAALQNSNDSLPWKSQLHNIEAFCPLPEERWIEIHEENRSYKPTA
EDVGHVIRVECKATKRVGGSVLIKTVDTGIVLPFPPMPPKRQMLANVHEERPTPRLRQIG
MFRVLTYNILAEIYATRQMYPYCPVWALSWSFRRELLARELQTYNADIICLQEVQGDHYK
KFFVPMMTDLGYECWYLKKTRESMGLEGKVDGCALFYKRNRFIMKEQYPIEFNEIAKNFL
DGIMNEFDMTYPTALMSDREAFQQTVSKMRQRLMRDNVSQIAILEAIPANNEISRKSQSG
PLVCISNVHIFSNPKFPDVKLWQTHALVKQIERIALVRNLPVILCGDFNSEPISAVYEFM
TRNHVSANHVDLSAHANIYATMDLEHNFSFASAYASVFGTEPEYTNYTGHWTGVVDYVWY
TPDQLTAFAGLKVHPPEVLESYAKTALPNCQYISDHVPLCLDFCFKAASTNGRYL
Download sequence
Identical sequences K3WKU2
PYU1_T005584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]