SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005588 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005588
Domain Number 1 Region: 181-286
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.58e-23
Family Dual specificity phosphatase-like 0.0016
Further Details:      
 
Domain Number 2 Region: 361-445
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000948
Family PLC-like (P variant) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005588
Sequence length 714
Comment protein Name="PYU1_T005588" Note="Similar to cnrN: Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase cnrN (Dictyostelium discoideum)" AED:0.120465960156682 QI:0|0.37|0.22|0.88|1|1|9|0|714
Sequence
MFKKFSERFPAAAKGLESLTGAHASAGISAAPSSASTSDAALPSENAENTNSAGNQNTDG
DAAQKQQKADGDKEGETTTNAAGTPPKSDDRISHVKAAIAEKINSESVSAAASIAASSMF
GLMKKAQSVASVAAREGAAKATVWKNKALDAADMDALQRRLSYALDRSTGEVNLELLNFS
YITDNIVAMGFPSMNSGMNRTANEAYDYTYFDNQVLEFNFPGHPAPPLGLVFKICSSIEN
WLQADEKNLAAIHCLTGKGRTGTVIACYLAWIGQFPNAMESLEYIQYFTNVMDGVKPRSS
PLLLRRVIINTIPVFGTRRVLEPTKKQDEGEEKTEAEGDEAAAAAASQEVNEEEMQEIVE
EGCCPYLQIFKGGKLVFTTTWRDMETGNGVRHLTDSGERISMFRGAFHTGYIPQGILRLT
KAQLDGACGDPRFDQDFFVDLIFADVETDNDSHTQPDGSVVTNGPKSEGVALTEEDRQAY
EDMLHRDEAFWVDIEARKVRLQKLREEQQKKKQQEAEAAAARAAEAAAAAETAALAEQAQ
KAKEEAMKKQSSFSIVGGDEDEHFNKSTKVNRKGSWDEAKDKELMSELESITSGALAKAA
SDDSLLLSSDLEEKATDKSTPATDSDAMAGLAKEFEDMKNLEKELGLESFSSELASLPDG
KLDARLDALDAELQGLGSLSPTAKDGAAKDVMNFAADDFDELEEYLSGLSTSSS
Download sequence
Identical sequences K3WKU6
PYU1_T005588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]