SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005644 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005644
Domain Number 1 Region: 20-151
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.25e-41
Family Type II thymidine kinase 0.0000126
Further Details:      
 
Weak hits

Sequence:  PYU1_T005644
Domain Number - Region: 152-171
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0808
Family Type II thymidine kinase zinc finger 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005644
Sequence length 175
Comment protein Name="PYU1_T005644" Note="Similar to TK1: Thymidine kinase, cytosolic (Gallus gallus)" AED:0.0883116883116883 QI:0|1|0.5|1|1|1|4|0|175
Sequence
MSPPHVLSSSSFATMRTVPGHLQLIIGPMFSGKSTELIRRMRRFHHAKLQCLVIKYKNDT
RYSDEKLSTHDKLLFEAKPVERLAEARAHVANADVIGIDEGQFFPDLVEFCLEAADAGKV
VIVAALDGTFERKPFGSVCELIPAAEQVIKLNAVCTKCGHDAAFTRRIVADTSVE
Download sequence
Identical sequences K3WL02
PYU1_T005644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]