SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005649 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005649
Domain Number 1 Region: 95-157
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000538
Family Centromere-binding 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005649
Sequence length 437
Comment protein Name="PYU1_T005649" Note="Similar to PDC2: Protein PDC2 (Saccharomyces cerevisiae)" AED:0.149919782796495 QI:0|0|0|1|1|1|2|0|437
Sequence
MASINPDALQMAHQQQQRAQQQKPHVQRRNLSYQEKLMVIRKKDAEPSWTQENLALWARE
QFKLNTKPTQATISNILRSRDKLQCMNVPPDFRSARPVKNPELDLAMIRWVLSMLSNNAP
LTRDAIQQRAVALAEEMKITTGITFSKGWVSSFMKRHQLHFRKKQGDSVDADLEVIRQPL
VPAAIAPPASNEAAPAPAPSVAVGDVAPASAKQPNKRKRAPNNAVITSAAAPATTTMNLR
DLTGIEVRVKIATLVNSFKAANSWLSETGLHEALGIERAAGGNDVKSHVLQLCKHYDLLA
PVLTGHVSSGNDEEGEDNDVEMEDHDVQAKRDQEAAAKLAAVNSNKSIPSPKSTPPLAAN
KKRRNSTNGSSSKQQQVDKQLGIDREKQQQLFDLECQKLQVDIEAKQVQLMVEKTLARKK
LLDAGIPVAEVDKIFPM
Download sequence
Identical sequences K3WL07
PYU1_T005649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]