SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005711 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005711
Domain Number 1 Region: 125-230
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.76e-25
Family Canonical RBD 0.00064
Further Details:      
 
Domain Number 2 Region: 8-109
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.12e-25
Family Canonical RBD 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005711
Sequence length 603
Comment protein Name="PYU1_T005711" Note="Similar to HNRNPA1: Heterogeneous nuclear ribonucleoprotein A1 (Homo sapiens)" AED:0.0412695701058682 QI:0|0.6|0.16|0.66|1|1|6|0|603
Sequence
MSDSSAKLGKIFIGGLSYETTDEKLRSYFAAYGSVTDAVVMKDPISRRSRGFGFITYADP
GCVDRALAHPNHILDSRRVEAKRAVPRAESARDMTSSSSSSSSRGMSNSSSIPSSNLSLN
SSHIGATKKIFVGGLHYETKDADFKKYFAQYGKVVSAEVMFNRETNKSRGFGFVIFEVEN
SVDLVLQEPNHVIDGKSVEVKRAVPRTDVPPARSVSSRAGSFSGTGGPGSVGSLEDVSVS
STATLSMPGTPSRATGSSNSSRSAMSSSPAPANLMANGTLVGYAAAVRYGGRGIPKPTSS
IAPVLPPSAITDSYKNNDDSDDHAPPDGVADALSSLALGDSSATPSLSASSSLESPSKLL
DAAGNGHFSPLGSAIMSPLAADPVIEQWNLSPAAPPQPSVSSEVPFLGQSKSRYLSGAIR
NDDVTDESSQLPWQAAPWDHAWPSLQPQQHSNAPESQRSPSSPSFFPMFSTQGMNASGSP
MSESAWNPPEYVTGNGFGNGMMGMGGSGFGSNGSNGRMGRGGGAFGNGGLGGVPRSSSPY
SSLGGFLQAEYLPQQEPELPLDTGFGSLIADANLGPDDSELEKKQHLDFALPSSSTGFQR
HYR
Download sequence
Identical sequences K3WL69
PYU1_T005711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]