SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005737 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005737
Domain Number 1 Region: 50-139,206-440
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.73e-40
Family Extended AAA-ATPase domain 0.023
Further Details:      
 
Domain Number 2 Region: 139-218
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.91e-23
Family TIP49 domain 0.000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005737
Sequence length 470
Comment protein Name="PYU1_T005737" Note="Similar to RUVBL2: RuvB-like 2 (Bos taurus)" AED:0.0148536209553158 QI:0|0.8|0.5|0.83|1|1|6|72|470
Sequence
MVRYDAYAWSASVKTQAEIKDITRIERIGAHSHIRGLGLDDSLEPRGVSQGMVGQEDARK
AAGIVYKMISEGNIAGRAILLAGQPGTGKTAIAMAIAQALGEDTPFTTIAGSEVFSLEMS
KTEALTQAFRRSIGVRIMEETEIIEGEVVEIQVDTPTGGIGDKVGRLTLRTTEMETVYDL
GAKMIDSLTKEKVEAGDVITINKESGKITKLGRSFTRSRDYDAMGPQTRFVQCPEGELQK
RKEVVHVVSLHEIDVINSRSQGFLALFAGDTGEIKDEVREQIDTKVAEWREEGKATIVPG
VLFIDEVHMLDIECFSWLNRALESDMAPVLIIATNRGITRIRGTNYKSPHGIPIDLLDRL
MIIPTKPYSEADMRKILTIRCEEEDVEMTEEAKDLLTRIAVETSLRYAIHMIIAASLVCA
KRKGTEVDVPDIKRVYGLFVDVKRSTQFLMEYQKEFMFNEIDDELEDMEE
Download sequence
Identical sequences K3WL95
PYU1_T005737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]