SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005759 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005759
Domain Number 1 Region: 75-129
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000125
Family Centromere-binding 0.028
Further Details:      
 
Domain Number 2 Region: 146-209
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000627
Family Centromere-binding 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005759
Sequence length 360
Comment protein Name="PYU1_T005759" Note="Similar to Tigd2: Tigger transposable element-derived protein 2 (Mus musculus)" AED:0.0983379501385042 QI:0|-1|0|1|-1|1|1|0|360
Sequence
MTPSAINGGLAAMDAAAAAVGPTAAAAVLPGVTAPSTPSHGAAGLSADEGDESHGSSGGG
GGGGGGGGSSSSANKRKRVVLSIHEKQQVLHRLDAGEQPVVIARHFGISRQQVSDIKKNK
ERILSFCVDAKHVSSLRRKTLKATSDYHPGVEQELYRWIIRQRRLNRAVSSDALTNKATD
LFMQYSAEDSTVSFKTITNWLRHFKRAHGIKMFNEEELAKLPERFVPSMDMSRALASANN
NIHHHHSLPSPASSSTIGVTTNNGMGLPPSMHMNVDDYINGMSNMLVLHANPQQHHDAAA
AATGVAGADALKHPLMAAVNTIHELSAQLSYFEREMAIKLDYLDARVEKLCFTMLPPRFA
Download sequence
Identical sequences K3WLB7
PYU1_T005759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]