SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005764 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005764
Domain Number 1 Region: 4-334
Classification Level Classification E-value
Superfamily Clathrin heavy-chain terminal domain 1.44e-112
Family Clathrin heavy-chain terminal domain 0.0000000421
Further Details:      
 
Domain Number 2 Region: 1198-1531
Classification Level Classification E-value
Superfamily ARM repeat 8.06e-97
Family Clathrin heavy chain proximal leg segment 0.00000000899
Further Details:      
 
Domain Number 3 Region: 450-785
Classification Level Classification E-value
Superfamily ARM repeat 1.12e-90
Family Clathrin heavy-chain linker domain 0.00086
Further Details:      
 
Domain Number 4 Region: 337-491
Classification Level Classification E-value
Superfamily ARM repeat 9.78e-52
Family Clathrin heavy-chain linker domain 0.00000286
Further Details:      
 
Domain Number 5 Region: 894-1073
Classification Level Classification E-value
Superfamily ARM repeat 8.06e-31
Family Clathrin heavy-chain linker domain 0.029
Further Details:      
 
Domain Number 6 Region: 1075-1195
Classification Level Classification E-value
Superfamily ARM repeat 3.74e-19
Family Clathrin heavy chain proximal leg segment 0.004
Further Details:      
 
Domain Number 7 Region: 781-892
Classification Level Classification E-value
Superfamily ARM repeat 0.0000184
Family Clathrin heavy chain proximal leg segment 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005764
Sequence length 1721
Comment protein Name="PYU1_T005764" Note="Similar to Cltc: Clathrin heavy chain 1 (Mus musculus)" AED:0.00114035949136304 QI:91|1|0.5|1|1|1|2|0|1721
Sequence
MAQDLPITFGEVLNLGALGVNPDYVKFGTTTMESDKFVCVCEQVNGQASVVIVDLSAGNS
VQRRPINAEAAIMNPVSKVIALRSENQLQIFNMELRAKMKSHLMNEPVVFWRWVSVNLIA
LVTGSAVYHWSIEGDSAPVKVFDRHANLGPGTQIISYEASHDNKWMLLVGIAQGDGGRIV
GNMQLYSMEKKVSQVLQGHAGAFAEMTPPGRTDKGQVLVFAGTKGDTPQQLFIMEVGRDR
DAPGGVFRLPPQNIPFAADAQNDFPVSMLVSPNDDVIYMITKMGYLFLFDAHTGKPLYRA
RVSQDTTFVTTLDSKSKGMLGITRRGQLLQFAINRTKLVPYVVNTLRDSQLALALATRLD
LPGAEELYFTEFNRLVSVNDIQGAARLAAASPQGALRTPQTIQRFQQMPAQPGQPQPILQ
YFSVLLEKGTLNKMESIELARPVLMQGRGQLLQKWLAEDKLECSEELGDLVAQSDTTMAL
SVYLRAQVPEKVINCFVQRGEFDKIVAYAVQTNFRCDYTFMLQNLVRANPQGALDFAQKL
AVADNGPLVDVNSVVDIFMQVNRIQETTAFLLEALKNNRPEEGYLQTRLLEINLLGGSPQ
VADAILSNNMFSHYDKPRIAALSEKAGLFQRALEHYTELPDLKRVIVNTQAINHEFIVTF
FGTLTSEVSMELINALLAHNMRQNLQIVVQVATKYAEQLGGKELIDIFEKFKSFDGLYYF
LGSIVNFSQDPDVHFKYIEAATKMGQFKEVERVCRDSSVYDPVRVKEFLKESKLQDPRPL
IHVCDRYDFVEELTQYLYSNNLLKYIDVYVTKVSPQKTPTVIGKLLDLDCNEDYIKNLLN
QIPQCPVDDLVDQVEKRNRLRLLQPWLETRVSQGNTETATHNAIGKIYITLNREPQQFLT
NNQFYDSQVVGLFCEKLDPALAFLAYRRAGGACDEDLIRVTTENGLFKDLARYLVERQDL
DLWGKVLVKQEEGESESPNRRALIDQVVQTALPETKNPDEVSTTVRAFMNAELPSELIEL
LERIVLQGTDFSNNKNLQNLLILTAIKAGKDKVMDYVNRLDNFDGPDIARIAVGEQYQLY
EEAFVIYKKTKHNVDAIAVLLENINDLERAYEFADRCNESEVWSKLAKSQLDRNLVHDSL
SAFIKANDASAYVDVIAAAERANDYGELIPYLKMARNTVKEQYLDTSLIYAYAKCEKYGD
LEEFISAPNVAQIQNIGERCYDEGMYNAAKLLFQNINNNAKLAICFVRLGKFREAVDAAT
KANSVGTWKEVNYACVDVGEFRLAGLCGLHIMVHPDHLEELILHYERRGHSTELLKLMEQ
GLGLEGAHAGIFTELAILYSKYLPSKLMEHVKIFHTRMNVSKVLRACEKGLHWDHAVYLY
KEDGQFDNAVRTMVDHPVAFAHDLFLDCIQKVRNQEIHYKAINFYLEQHPLELTRLLQVL
TPNLDHARVVHQLRKTHNLPLVVEYLKDVQKENLSAVNEALNEILVEDEDYVSLRESIDS
YDNFDQITLAQKLEKHELLEFRRIAAYLYRKNKRYTQSVKLSKLDKMYKDCIDCAADSDD
PELAEDILRFFVTVHDKECFCATLFTCYKLIKPDVALELAWRNGYVDFVMPYMIQFIKNL
NEKVKVLDERTRVKQEAAVETAAMDAQYGMGGGLQPMLAIAPTAFNDPSAQYGVGMGMNP
AMGMQQGYAQPAMGMSQGYAQPGMGMGGMPGVNPYGGGYQY
Download sequence
Identical sequences K3WLC2
PYU1_T005764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]