SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005772 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005772
Domain Number 1 Region: 269-422
Classification Level Classification E-value
Superfamily EF-hand 1.5e-37
Family Calmodulin-like 0.00088
Further Details:      
 
Domain Number 2 Region: 158-224
Classification Level Classification E-value
Superfamily EF-hand 2.49e-21
Family Calmodulin-like 0.0029
Further Details:      
 
Domain Number 3 Region: 3-101
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.46e-19
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005772
Sequence length 435
Comment protein Name="PYU1_T005772" Note="Similar to CNB1: Calcineurin subunit B (Ashbya gossypii)" AED:0.0697368421052631 QI:0|-1|0|1|-1|1|1|0|435
Sequence
MDTADPYVKLTIGAQNFQTKVHEKGGKNPEFNENFDFNISTEKELVIEIFDKENSGKDRF
MAQVKVDIAPWLTKGGFEGDLEFLDAEGQAGGKLSVVAKFAKPAATPGGPVKTPPMAPPV
LSGPAVAPLPPGANAVSIPGAPPFAPSEPPRDPNGKFTDKEILEAFQAFDLDHNNYVGAA
EIRHVLINIGESPTDEEVDEMIKMVDKDGDGQVSFDEFYAMVARGKQPPPGLGVTATASP
EKMAGGTGSTAASGAQAIQLRNQRKVALEEFARDNGVKPESVKKAYKRFQATDKDGSGQI
DYSEFCEVMQVDPSPQTEKVFQLFDNDKTGRIDVREFMIALSNFSGAEKDEKLKFAFMVF
DEDGNGVITRQELMKILKANHMASNESEVARKADTIMSQGDKDGDGVISFDEFAIVSKKF
PNILFPAYTLGTTKD
Download sequence
Identical sequences K3WLD0
PYU1_T005772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]