SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005778 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005778
Domain Number 1 Region: 42-106
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000052
Family Fibronectin type III 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005778
Sequence length 134
Comment protein Name="PYU1_T005778" Note="Protein of unknown function" AED:0.0296296296296297 QI:0|-1|0|1|-1|1|1|0|134
Sequence
MATPSSSSSSLRRRPAPAKLKARTEFSVTLFVPAAVSTATQSAAATWYRFEYREAGAGGP
GGASWINAKSIDTKPGAAEVVLDDLNPTSTYEIRIYAVSRDDEGKEQLSEPSEVAAVDTE
VPGCGPESSKCVVM
Download sequence
Identical sequences K3WLD6
PYU1_T005778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]