SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005789 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T005789
Domain Number - Region: 49-59,101-201
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.0445
Family beta-lactamase inhibitor protein-II, BLIP-II 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005789
Sequence length 246
Comment protein Name="PYU1_T005789" Note="Protein of unknown function" AED:0.0763537449392713 QI:0|0|0|1|1|1|2|0|246
Sequence
MPRWSSPAGTVALSVALWCALLSPTAVAHTWIDCIDTDRSVVYDNARNWIFGGAAGNGLC
EGYMKNYPGRGDPDINTKMTFKILMADVAKGAPVCTSEPAVYGDLSWRKRIQVAPGKTFY
YAYLENGHITKDKAGRGTFYGVYWTGQPETELTLTTELTDARLVDGKLHDFDDKNCGQTF
EDGDFDGTIKSGRAGNDFSCVGEVTVPVGTKPGVYNMVWFWRFYNEDGGNSDIMTTGGHF
GGAAWR
Download sequence
Identical sequences K3WLE7
PYU1_T005789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]