SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005804 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005804
Domain Number 1 Region: 4-189,290-373
Classification Level Classification E-value
Superfamily DNase I-like 2.04e-23
Family DNase I-like 0.074
Further Details:      
 
Domain Number 2 Region: 187-247
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000855
Family PARP-type zinc finger 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005804
Sequence length 409
Comment protein Name="PYU1_T005804" Note="Similar to Ttrap: TRAF and TNF receptor-associated protein (Mus musculus)" AED:0.0531637990798512 QI:0|0.5|0|1|1|1|3|0|409
Sequence
MATKLRVLTYNVFFDPVCMEARMRAIGRIIARVRPALIGFQEVTRDSLALLKKQQWTRYY
DCSVDTAPPFSEAYFVVLFSALPVLALETLPFANTGMGRELVTMQVEVAPEQSLFVGTSH
LESMPQFARSRVSQLKESMQFLQDRVDRHNSSSSKKTKCLGAIFMGDTNLMRSDMKLLDP
KVGAAVSDLEVERAKSARSKCRKCAESIAKDAVRVGKMVKETVPGGRQLEVRWWYHEDCF
LKDATDVEKQFVQNSSVTVKDGATTTATADATTTSQTMDRSALGLPPGWRDLWLSVAGNT
EENGITFDGKTNSLVTSRAFQSRLDRMFFFPGESQRDAFASASILDSIELVGKEQISDGL
WPSDHYGLLASFSFGETDKSQKEQQGAEGPNPAKKAKTGATKDSAVEID
Download sequence
Identical sequences K3WLG2
PYU1_T005804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]