SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005812 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005812
Domain Number 1 Region: 27-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000191
Family Ubiquitin-related 0.0092
Further Details:      
 
Domain Number 2 Region: 134-161
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000192
Family Ran binding protein zinc finger-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005812
Sequence length 166
Comment protein Name="PYU1_T005812" Note="Similar to Sharpin: Sharpin (Mus musculus)" AED:0.546856553914867 QI:2|1|0|1|1|0.5|2|1|166
Sequence
PTEGTVSVEANNSGRQRRSKRIRGGAGGASWSILANSDDSIYVLKTKIYEEIDAYPIRQR
LYFKGNVLEDRLSLKDCGIKVGDAIFVRLSEDIPDETSIGDDALEREVGFEDSVFLRHNS
SNGSSHHHAGMTLESKVWVCPACTYVNEDIDQVCEMCTTEKTIEID
Download sequence
Identical sequences K3WLH0
PYU1_T005812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]