SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005814 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T005814
Domain Number - Region: 10-98
Classification Level Classification E-value
Superfamily DUSP-like 0.0112
Family DUSP, domain in ubiquitin-specific proteases 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005814
Sequence length 136
Comment protein Name="PYU1_T005814" Note="Protein of unknown function" AED:0.647940837971779 QI:0|0|0|1|0|0|2|0|136
Sequence
MPVLPDDLNPYLMSRAWIASYKAHLQSVQKKILQKPKKKKLKTNGGSQDKSAQETADSSE
TGDTVWQASLNEDITCVHGNLFLKKKKYRVVPASTWIFPLTLRSKSGLPNHAHNVKLTKQ
RVKNLSKSSARVETMY
Download sequence
Identical sequences K3WLH2
PYU1_T005814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]