SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005847 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005847
Domain Number 1 Region: 284-340
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000383
Family DNA-binding domain of telomeric protein 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005847
Sequence length 344
Comment protein Name="PYU1_T005847" Note="Protein of unknown function" AED:0.283221850613155 QI:0|0|0|0.25|0.85|1|8|0|344
Sequence
MRAALETVAEFLSKYGALEEANNIMNVMAKMGWSVPADSKLQWRSLVAAMKQELNAPEAA
PDYVFLFERLIQLCIKMPGDLWKSLFSSKLLMHIVVERFAIAFESHDAELFKLESDVLCH
TEGIFDICQLVQNKLFSEDVGTSVLAQFLADFSTIFEDDEPKVARWDEFYSSYRMHEASF
RRDMKRALCQIEASGIGPTQIEIRKRIRREAVEGRFPGTSGDLSDSTLSEPEDSTCRVQN
SSRNGPPVTTNSAAAASPPPVADQQETAPSDSASAEDSPSPKVRAKRKRWSTAEVEALRK
GYKEFRALPNVWMMIKTKYADVLASRSNVDIKDKYRNLLKFGKL
Download sequence
Identical sequences K3WLK5
PYU1_T005847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]