SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005850 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005850
Domain Number 1 Region: 31-119,264-384,860-1079
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.28e-31
Family Calcium ATPase, transmembrane domain M 0.034
Further Details:      
 
Domain Number 2 Region: 385-401,606-712,760-867
Classification Level Classification E-value
Superfamily HAD-like 6.34e-30
Family Predicted hydrolases Cof 0.047
Further Details:      
 
Domain Number 3 Region: 115-186,222-264
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 7.06e-20
Family Calcium ATPase, transduction domain A 0.0066
Further Details:      
 
Domain Number 4 Region: 396-421,472-678
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.68e-19
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005850
Sequence length 1123
Comment protein Name="PYU1_T005850" Note="Similar to Atp8a2: Probable phospholipid-transporting ATPase IB (Mus musculus)" AED:0.234536075444112 QI:0|0.91|0.84|1|0.91|0.92|13|0|1123
Sequence
MDHRHSIATKQYRMVDPFRIERDENTHAKPTYISNVIRTSRYTWLNFLPLTLLQEFRRSA
NMYFLIIAILQSIKVISPLTPFTAIAPLVMVSTVSLLREALEDQKKRVSDHQTNSRPVVV
VRNFEEQCILWESIEVGDILRISEREIIPADGIILSSSEEDGTCFIDTSNLDGEANLKFR
EPVRATLKFQFSKSDREKTKYFIKCEQPDQDLYRFSGNISIDSKMFSLSEKQLLPRGSTL
MNTKWINMVVVYTGHDTKIMKNARAAHHKLSHVEIMTNKTVVVVFILEVILCAIAAIVHH
VRYSKGKATKMRYLLEQDGTLMEPVLLFLSFVVLMNTLIPISLVVTVEIIKGIHAKFITW
DDKMRNASGEGAIANTSSLTDELGQVKYIFTDKTGTLTQNQMEFRKCSVGGVVYGSLDKK
GRPRAVSISSLDVIAREVSAVSTRDFGSSGSLAGSDLRSVTCFRTFLRDLESKESKLALS
MAICHTVVCENDLASGEIKYNSDSPDECALVRGAVSMGVKLLGRNGQHIYLSLTEEGREK
SYLKTVTYTLSYEILRTLHFTSDRKRMSIIVRDSERRIKLICKGADSVILDRCEQFLSSK
QETMDHVTQFAVEGYRILLFAERSLEDGFYEAWESRYQEAELDMNFREEKIEALVEEIER
KLTLIGSSAVEDKLQEGVPETISLFQKAGIKIWVLTGDKLETSVEMGKLCRVVTPGMREI
ILRGSTREEMSQRLDTALREAKDNQALIIDGSSLTYALMPANRECFLSLALRSATVIVCR
TSPLQKALVVELVKTGVPYVTLAVSLSNPCSGDGANDVSMIRAAHVGVGVTGQEGMQAVR
SADYAVQQFSHLGRLLLHHGRLSYIRTAQCINYFFYKNIVFTLPQIIYGALSAYSGQTFF
CDLYITAYNVVFTALPVIVRAIMETDLPEKVADTFPELYRFGAMDEYFSITTVVKSGLLA
TFHALLLTLLPITIQSIGSLGADGKVGDLWSSSVASFFFIVPVVHFQIYFDTWNWTAFVG
SSYAASITVFLVSVAVYDNVASDVEGVWGTAVVTPIFWLGFSLSTVACLLPWIAYKCYQE
NFVTTNPVHILRRVRFFNKILDSSQVEKLNETSQATGPRPVEN
Download sequence
Identical sequences K3WLK8
PYU1_T005850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]