SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005853 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T005853
Domain Number - Region: 21-45
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0466
Family Myb/SANT domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005853
Sequence length 143
Comment protein Name="PYU1_T005853" Note="Protein of unknown function" AED:0.111111111111111 QI:0|0|0|0.5|0|0|2|0|143
Sequence
MGTASSTDRVLTFLQNARVQNIPVRSGKWNPEEEEYLRKLVELFCLGVLDDVEQKSSMRA
WLSKMLNCCPMRISKKQMNGEKFIGKAKFKKNIELIQQMTQEHYDEACDEVHRLRSSFLK
HWAKDEFAKRTTRDKPTSFEEWF
Download sequence
Identical sequences K3WLL1
PYU1_T005853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]