SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005907 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005907
Domain Number 1 Region: 353-640
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.86e-67
Family Regulator of chromosome condensation RCC1 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005907
Sequence length 746
Comment protein Name="PYU1_T005907" Note="Similar to HERC2: Probable E3 ubiquitin-protein ligase HERC2 (Drosophila melanogaster)" AED:0.188638612420697 QI:0|0|0|1|0|0|2|0|746
Sequence
MAGSIRAGAPEKFYRGRRGSDAALVGRTPPRAPPLLSIVGSRRNGISGGFSGPRARPSVI
FSSQQLGVTVGGCAAFYSAVLSCEPEHPVAIYPGNLPACIRVSPSLLVFSHEDWRTPQFF
RVTVLASVHDDNNKDDCKLQVIEHVGSSMDSRFNGNKILYLPPTVLVQITGREGCYLFTS
GNSLATITASTTGDPRAKASFSSSTYHEFVQIELDATPNPPQLSLQKVSVASAAGITNDA
LEAQDGVSALVSRRSSSRRNLTASASSASLAPSLQSLQSSSVDGHYHSTHRDGTALVKAV
CRADHTLLLYKSGNWGMLGTMHVDYSTEEQTLEADLIGVYGSRGSNSTLSRMLIDIECGD
AHVVALTEQGYVMTWGEGKDGRLGHGKACSIRAPHVVKSLFHKRILHIACGARHSVAVAE
DGDVFSWGDGKCGALGHGLNEHEQHFDLVNMPMEILSLKSKGVARVACGDMHTAVVLLDG
SLLTCGWSANGRLGRNCPKKSEFSSVFELVDMKTRLCAFVVCGAAHTLVLTECNSVYGFG
WNGSGQLDLGDRRTRGVPTKIQYFATDDLIVVSLAAGKLHSMAMTQDARAFAWGSDELGQ
CGIGSFPQIYTVPHLVASTVGVSATQISAGESHSVVLTTASQKQLDALEVNHPSRYASLM
ESFELFVRRDRELQAKVLAFAKENEWKREAARRNRKPPIDPSFSLARTLQQELLGIENNN
SAHEPSRLSTAYGRCSAFTAFFVYDR
Download sequence
Identical sequences K3WLR5
PYU1_T005907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]