SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005913 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005913
Domain Number 1 Region: 11-175
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0000000445
Family Rhomboid-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005913
Sequence length 239
Comment protein Name="PYU1_T005913" Note="derlin" AED:0.0471441523118767 QI:116|0.8|0.66|1|1|1|6|163|239
Sequence
MNDPLEWYYEIPIISRLYLTGSLLTTTACALDLVSPFSLYFNFNLIFFKGQVWRLLTNFL
FFGLFSIDFLFHILLEEGSFRGRTADFLYMLLLGATVMILLAPFVNIHFLGSPLTFMMVY
LWGRRNEHVRMSFLGLFPFTAPYLPWVLLSFSILLGNSATTDLIGIVVGHIYYFLEDVYP
TIASIRGWKTQRPLATPRILKYLFETRPTIAENVINDMVPPENVVLDENERVEEHPHND
Download sequence
Identical sequences K3WLS1
PYU1_T005913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]