SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005926 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005926
Domain Number 1 Region: 61-181
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.94e-31
Family Myf domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005926
Sequence length 209
Comment protein Name="PYU1_T005926" Note="Similar to pheT: Phenylalanyl-tRNA synthetase beta chain (Erwinia carotovora subsp. atroseptica)" AED:0.347406478141934 QI:0|0|0|1|1|1|2|0|209
Sequence
MLSRRIVAVRAPLRRLHATRFQWFSGAAGADSPEHASSEQEEAKPVAQVKKQQPPPSPPT
TTWNSLVIGEIVDFHPHPTADRLNVCQVNIGDKDTLLQIICGAPNVRQGARVPVATIGTK
LAIKDPASGDIKLVKIKKSKLRGELSQGMICSEAELGLTDESDGILILEDDAPVGSLVAD
WGSVARRLAKDENEATPASILTSSDKVAQ
Download sequence
Identical sequences K3WLT4
PYU1_T005926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]