SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005953 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005953
Domain Number 1 Region: 5-103
Classification Level Classification E-value
Superfamily Bet v1-like 0.0000000000646
Family STAR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005953
Sequence length 112
Comment protein Name="PYU1_T005953" Note="Similar to STARD5: StAR-related lipid transfer protein 5 (Bos taurus)" AED:0.436965414652287 QI:0|0|0|1|1|1|3|0|112
Sequence
MAKKLKYYLSDECPWKVIKTTSNGVISEMATNDTPYPLFKFEMFISGVSMEKFIDFLDRK
DMKYRSLWDLNVANFRVVESFAEEKNVFVCHNMQKSFLGGLVAALSSIQMYL
Download sequence
Identical sequences K3WLW1
PYU1_T005953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]