SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005954 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005954
Domain Number 1 Region: 235-284
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00006
Family Leucine zipper domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005954
Sequence length 489
Comment protein Name="PYU1_T005954" Note="Similar to lig1: DNA ligase 1 (Dictyostelium discoideum)" AED:0.0183673469387755 QI:0|-1|0|1|-1|1|1|0|489
Sequence
MDARRDSTSSAAQPEGRRSSATLNDSSNSPPLGGMMSGIDWSIFKDSEEDAFGWLLRTNA
AAAPATPENPIPNDAVALPLLSTDALSLEEIQMDDNEESMLGLERSVSVKASSNPTDAKI
KQEGVANHALTANSLAAHLHSNAGRAKRNNKYKQPPPSQFEANISVDGSYDDLGDDDDFV
DETGYNSDDQQSIVSHGTTPRPSAASENKGKRAIKRKKSVASENADGEDLGEDQDKKQQR
RVKNLASVREFRKRKMKQMEQNEHRLRRLEAENLDLKMRLKIGKEAIISEQREKQQIKEQ
MREMLQHNASEQEIARFLNMYKVTYSDYGPKRREKLRFHLERIRELLLPTQVTKLCLYSV
EQGKDMIARDHVIKEDPMSMSDSSAAPMSLWGILAKELDVSDTQQRQILERRTSIKKVQD
DLNHTLSILSQLEQVTDEKNTALETQVAELQQILTPSQATKFIIWVKENPAFMYMLDKLV
DKTLRNTDA
Download sequence
Identical sequences K3WLW2
PYU1_T005954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]