SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006025 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006025
Domain Number 1 Region: 246-391
Classification Level Classification E-value
Superfamily S-adenosylmethionine synthetase 1.69e-61
Family S-adenosylmethionine synthetase 0.000000723
Further Details:      
 
Domain Number 2 Region: 122-245
Classification Level Classification E-value
Superfamily S-adenosylmethionine synthetase 7.77e-52
Family S-adenosylmethionine synthetase 0.00000477
Further Details:      
 
Domain Number 3 Region: 12-117
Classification Level Classification E-value
Superfamily S-adenosylmethionine synthetase 1.68e-47
Family S-adenosylmethionine synthetase 0.00000607
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006025
Sequence length 393
Comment protein Name="PYU1_T006025" Note="Similar to METK2: S-adenosylmethionine synthetase 2 (Suaeda salsa)" AED:0.00505691432087363 QI:0|-1|0|1|-1|1|1|0|393
Sequence
MTQTEEVKAGRTFLFTSESVNEGHPDKLCDQISDAVLDACVAEDPNSRVACETCAKTGMV
MIFGEITTKAVVNYEKVIRETIKQIGYDDPAKGLDYKTVNVIVAIEQQSPDIAQSVDSVT
DEDVGAGDQGIMFGYATDETEEYMPLSHTLATQLGAKLTEVRKNGTLDWIRPDGKTQVTV
EYKQENGCMIPQRVHTIVISTQHHDDVTNEQIAADLLKHVIQTVVPEKYLDDQTVYHLNP
SGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDTTKVDRSAAYAARWVAKTLV
AKGLASRILVQLSYAIGVPYPLSIHVDSYGTVKDGRSDDDLVEIIKKNFDLRPGVIQRDL
KLKRPVMQKTAAYGHFGREDEDFTWEAVKDIQF
Download sequence
Identical sequences K3WM33
PYU1_T006025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]