SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006039 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T006039
Domain Number - Region: 30-102
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.000824
Family Lambda integrase-like, catalytic core 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006039
Sequence length 155
Comment protein Name="PYU1_T006039" Note="Protein of unknown function" AED:0.169957686882934 QI:0|0|0|1|0|0|2|0|155
Sequence
MNYLSNIRRQFEENTQYLLRCVQEGKSLKTQAPIVTMVNLKCIGRALFKQNDRTSLKDRS
LMNQQLSAVGRSSEISGLRYDDLQWMDSYLLARMSHIKTSTQHSLSVFGSALHLEIDPFS
LTRMPAGCESVRRFQLDFQPNLRDHLKRGENSVLH
Download sequence
Identical sequences K3WM47
PYU1_T006039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]