SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006048 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006048
Domain Number 1 Region: 135-219
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000134
Family Canonical RBD 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006048
Sequence length 231
Comment protein Name="PYU1_T006048" Note="Similar to snrnp70: U1 small nuclear ribonucleoprotein 70 kDa (Dictyostelium discoideum)" AED:1 QI:0|-1|0|0|-1|1|1|0|231
Sequence
MSGRYRGDEGRYGGGREDRDRSYGRGGDRGRDRDDRGGDRGRHQSDRYGGGSHYGSRNDR
NDRRGGDREGGDRSRSDRPAYGSSLSSRYGGGDDAPRRTDNSSSHYGDGATEQPTADDAV
PVASSAWDPKKEAENDPTWARIYVSNLPTDITSDELQEMFGAIGLVAREKQKRGYKDQWP
YKIKVYTDESGQVKGDAVITYEDANAARTAPEFFNGTHVCIKCCIDACKTT
Download sequence
Identical sequences K3WM56
PYU1_T006048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]