SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006102 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006102
Domain Number 1 Region: 625-665,696-929
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.8e-53
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00014
Further Details:      
 
Domain Number 2 Region: 135-181
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.63e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0028
Further Details:      
 
Domain Number 3 Region: 343-399,439-540
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000121
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006102
Sequence length 1006
Comment protein Name="PYU1_T006102" Note="Similar to MIMI_L615: Putative phosphatidylinositol kinase L615 (Acanthamoeba polyphaga mimivirus)" AED:0.0159364925998491 QI:0|0|0|1|1|1|2|0|1006
Sequence
MYAAQDRREREREAAVDLSFSQILEVRSSSYKRRPHASNGSSLPRFQRQLHRHSAPSAFK
TPPSSHGRSMLDSVYEDSEETSVYSPMQRRETRGLSSGSLGGSSSSFTEDEEWLTGDEQV
GKDMYRFVQPRRLSSWVQDDAVNACFKCHTLFTMIIRKHHCRACGRIFCSACSSQRVVIP
GDYESTPASPQYNSLTSNASDLIGNISWYFLSYSGAPTSSSGSHNGMRSSVYLDASQRVS
PEAQQEKFLKDVQRLQKQGAIGKFTPCANPSGSASTPSTKSYMSSHVPDGSVMQRVCDDC
ACSLQQRRNHYNIVKVFELCGFNLQELRVVGQVCRKWHRASIMCLSMLRQIQYYLPTHRL
SEREKALLIINRKFLTGHTKWILQLVKAIDFSNECEETSDGKQEPKGSNGRDTAVLAKDV
LSIIQQPRKHKCMLTMCSRLCQPQIGSVDALEILADENIRNKKLRAMCIDALLKTATENE
WLSYLPVLLQSLSIESNAAGSKLGQALIRQAHCDIRFCYDLYWGLTVTSEDASCRRKFDG
MKQRLLLTLAQFKHNATYGPDEQRHDDIAEQLLRGQEFVDLMWKVPHRVPIREVRQHFQE
SVERSLIFEGLDKANGEPSMNPQSPRPLLRLPVDPMVKVSGFNYKTIEVKRSAEAPMILT
CTGVERDEEDGDHRACAVDGKTERPAPPRSGRPRPPTLPYYRLMYKRDDLRKDAVVQNII
NVMYLILKQETRLDIPLVTYRVLPTSSFDGLIEIVENAHTLYSIIRDHNNILNFLHHYNG
DRTLSEISTSFRESLAAYTVITFLLGVGDRHADNVMLTKDGILFHIDYGFILGKDPKPLQ
PPMRLDHYMIEALGGAQTEQFEQFKKLCVIAFNCLRRHVSLFMILLNLVVKAVPEITDFD
MNYTQSDLEAFVVERFLPGQTDDEAATALMLRMEGKLNEKIGLKLSDFVHAHANEKTVSK
GMVSVGSSVKIGVEAVEATVSTVASSLSSGASSIYNYMWGSTMSGS
Download sequence
Identical sequences K3WMB0
PYU1_T006102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]