SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006103 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006103
Domain Number 1 Region: 31-92
Classification Level Classification E-value
Superfamily F-box domain 0.00000000017
Family F-box domain 0.0047
Further Details:      
 
Domain Number 2 Region: 174-327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000222
Family SPRY domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006103
Sequence length 346
Comment protein Name="PYU1_T006103" Note="Similar to ranbp9: Ran-binding protein 9 (Xenopus laevis)" AED:0.00169923534409522 QI:0|1|0.5|1|0|0.5|2|136|346
Sequence
MDVKPPQKRVKQQQQCEQHDDDEQQKRLGDALDADLLGVCISFLDYMSLVTCQSVSKEWH
RILQYPLVWEQFYATMWRPKCSAPLPPGYRRALLPHFKDVCAARMASQCALSTRARSWVR
DNGNVFVYNDAMYLRTFCMGGIESIHTESIRTESIRTESTLRPLASARALGVNVCYFEAS
ILGCGSVGIASISTTAERVAYGFGSQSHLGWFPVSYGYHGDDGLLYWNDCKMRIVGGAQR
AYGPSWGDATSLRRRQAAASVTIGCGFCLDTRQLFYTLDGRFLGLAPVTIKPSCAFAAAV
SLHQIGDSVEINFGCSAFKFDIDAYIWESARADSGARAFGHSVRAA
Download sequence
Identical sequences K3WMB1
PYU1_T006103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]