SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006123 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006123
Domain Number 1 Region: 149-216,257-309,355-463
Classification Level Classification E-value
Superfamily RNI-like 0.0000000122
Family Cyclin A/CDK2-associated p19, Skp2 0.066
Further Details:      
 
Weak hits

Sequence:  PYU1_T006123
Domain Number - Region: 57-77
Classification Level Classification E-value
Superfamily F-box domain 0.0262
Family F-box domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006123
Sequence length 582
Comment protein Name="PYU1_T006123" Note="Protein of unknown function" AED:0.226415094339623 QI:0|0|0|0.5|1|1|2|0|582
Sequence
MKKQKLVHVAQVALSPAAAAPTAAAAIPKHLFKYLLNFVACVIDFKFAPDGTTSPQESIP
CVALVCKAWYEVCNELDAEFHALVTEIAFETAQSDELQTIYRDLEARRGTLRELSLVMGD
VDYECNGHCTLKPDFESLATFEAQNIDWERIFRACPRLSRLDLFCVPLDCNHLTKILDAA
STYCPDLVSLIFPLAEIDATDEVASVGALPAISKLYEALERWHMTGSTRGLIQLSAPKYY
PDNNDDMLERTREFLTAVSRFCPNIEYLDGWKATYRNSNGLTCRDMRFCAHDVWKTFCAT
CTKLREFNWLTAPFDDDFLNAFADHAKKNLTRMTIACGNQVTGNYYNDGDYYRPGGFQFT
MECVSSMLAACPSLVELLVVFNDLITPSHRLKEEINDAFLRAVAEHCPNLKRLVINELRD
AGYESPLAKVTDAGLLAIAKLPFLEQLALKQTQCSHDAILSLITDAPSRDRKRQIALRMG
YSVDFQHTQPEEKLRNRRFELKLVVNTGRNYVPHEAPILRKLNALQTQVEECHPDVRVYF
CKGRAKTNHVCETLEYLESVVFVSPATANVSDLTDFTNDWVI
Download sequence
Identical sequences K3WMD1
PYU1_T006123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]