SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006144 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T006144
Domain Number - Region: 51-112
Classification Level Classification E-value
Superfamily F-box domain 0.000491
Family F-box domain 0.014
Further Details:      
 
Domain Number - Region: 172-359
Classification Level Classification E-value
Superfamily RNI-like 0.00589
Family Cyclin A/CDK2-associated p19, Skp2 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006144
Sequence length 426
Comment protein Name="PYU1_T006144" Note="Protein of unknown function" AED:0.077291721733439 QI:0|-1|0|1|-1|0|1|0|426
Sequence
MPVRKRAPKQHPLYAKRPRPSVAAPLANADSDHSDDVIVIAATLAPAVNDKPHSRPSFDV
SRLPSDALSRVLSFAVPGYVPVPGCVPKYPCLPVRKLSNVASVSTAWRDAIRKVIQNFRV
ANLDWTLVAADEEEEYEMLQEEVERRGDQLRSIRIRIDGDAKPADVEWGQVFAACPRLER
LDLRDVPLESSLLGLVLGAGSSHCRDMKALILPKRSVSSKATRKVIRANYEKLYQALEKW
SPLSSDDTTATGLKQLTVSDRWEDEYLAPSADFLAAITEFCPSLEYLDGWKHAYNVDDFV
ECDEKWYIPPSTWRQFWESAAGTSLREFNWAVAPFHDAYFQLFAEVLKPNLRHLCLTVSE
SWTWDDFKVPEDEDELLGAVIAPPTSETLCSVTKAVPQLEQLYVIFHSGIEDPASVDVEA
FGDPFL
Download sequence
Identical sequences K3WMF2
PYU1_T006144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]