SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006179 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006179
Domain Number 1 Region: 667-726
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000257
Family Homeodomain 0.011
Further Details:      
 
Domain Number 2 Region: 336-398
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000355
Family Homeodomain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006179
Sequence length 788
Comment protein Name="PYU1_T006179" Note="Similar to rickA: Arp2/3 complex-activating protein rickA (Rickettsia conorii)" AED:0.155893536121673 QI:0|0|0|0.33|1|1|3|0|788
Sequence
MSAMKMDFICKDSPEKEANGASEVASAPTPQVSSPAKQSTTPNAAKLSALLNSSHDSDVD
MDAEQEHERMDINVRQDNHKPQPPSSFEHAHEDGDNSVTVSTSAIEATAEDTPANQTDED
ISEKNGGLSDNEDSEDEQAEYAAWQDVDLNPAVDLVNKVVRESLEAGKTYNKSITAKTTQ
LITGCDNVLLELKNLSDARESSRKKTNKPGQDSGCDCVIALGMLPLVNKDAAVNAAAASQ
DTAKVAAKQSPVDEIAEDHTDRVLFKIEASMERLRELAEMIQATSMQGEANLVSKVTLQD
GTIKALDAAIQAGAAAATAAAIAQERGRTSSAFGRLYTPVQVKKLQEWYYSYPRPLTDEL
TLMRTILNYRPYSNPFQVNGLSISHVRDWFKRRRHRERMRFIKLAIESGRDPNAAAEEID
LRLEQRIEHLRATVDPNELVNEVDKVRADSPMYDSMVASFTSPSNLDSYVSASHALPSFT
DNQPPTQGRSKRQRTQESDLDYAMIVKVGNRIEVAALQNRIRSLLVLPRTATSTNALQQV
IDIMRSMEISPDVRIQTGIVADLKKILKIYKKPTLLRKSTMALLESLGMSRRAVLDDSII
EEEEPMKAEETVLENDTSEPPPPPPALPADDEDATMPPPPPPSGPPPAAGPKQRGKREKG
KILRPMKFSMNQVTALEGWFQQKYKPTQEEMEKYLEKLNAVPLRDEKQPLDVNMTQLRRW
FNKRRCLRRPPFALMTQHDSGKDSPKSDSKPGDHDDVNDDDDLDDDDSNDDSSDDDDDDD
DDSSDDDE
Download sequence
Identical sequences K3WMI7
PYU1_T006179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]