SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006191 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006191
Domain Number 1 Region: 532-675
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.24e-26
Family Synaptotagmin-like (S variant) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006191
Sequence length 687
Comment protein Name="PYU1_T006191" Note="Similar to fam62b-B: Extended synaptotagmin-2-B (Xenopus laevis)" AED:0.144981412639405 QI:0|0.5|0.33|0.66|1|1|3|88|687
Sequence
MSALSSGNWSAAHQTKWAWVAAAMSVAIMSMAVVLSEEKRRRVAAMIQGDDHAHADRMEL
RQRQRRRRRASDQPQYDLQQRDAVTLKPRRNSQMSPSADEGTRNILEQLDDEPSTPMPPG
LRLGNGMWDYVLLPLVTESIGFMGGLVVIYLAQVGRVYTAVALLVVLFALRVKSTAFSAA
FAPLTENSKVHLLKSLDRETLNDLLRDNLPRWVKFPDVEKCDWLNQTVETLWPYIKAAVA
KSVKEALTPALEAVKPKIMMTELGFRGLDLGTAAPMINGIKSQKHLEEQVVIDIDLLFAT
QNTDIVFSFGNPGSSMSLTIELSDFLLRGTLRVVMKPLFPRWPTFGAVFVSFTEKPTVDF
HLKTLGVNWMGLPALSSIFHNAIRSAIESKVVWPNKIVIPMVQDLSKIEMESLSGNKPLG
MLVVKNLRLSGVAPSNPLSRLMGMQRFQVQLSIGNEKITSEMIQGRDANNFEDQVYHLLA
LDPKTQALNLSLDCKETLRQFKLIDSKWIHLDHLVPHVDSKEFIAFGRDGVGQGEFELCW
YPFSGMSQVTRRLSAEAPLPEEIACMGGLFIKLVKCEKLAPMDYNGSSDPYVNFRVGSRV
KQSSIKATTLNPIWDPPEHFEMVVANHRHDILSVTVMDYDYLTADDQIGQVEIPLAQVQR
NGHMTKSWLLDNNSGAITLELEWKGFV
Download sequence
Identical sequences K3WMJ9
PYU1_T006191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]