SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006204 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006204
Domain Number 1 Region: 107-191
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.000000000000262
Family DNA polymerase beta, N-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006204
Sequence length 195
Comment protein Name="PYU1_T006204" Note="Similar to POLB: DNA polymerase beta (Bos taurus)" AED:0.136577708006279 QI:0|0|0|0.5|1|1|2|0|195
Sequence
MSREASKKAAKELLELCGKEGVKVPTEMITKFGKKESASKKRKADDVKAEKKPIAAKSRS
KKADDAEGDEHGKKAPSVRKTTKKTPAVISEDDEDDDEPKTKKARTKPTATNEANQELAD
AFAELSGFEFKRGEKFKGGTWSKVAKAVRDSEDKITSGKQAMKLKGIGKSSATRIDEFLE
TGTMSTLEEYRAGNM
Download sequence
Identical sequences K3WML2
PYU1_T006204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]