SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006234 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006234
Domain Number 1 Region: 317-423
Classification Level Classification E-value
Superfamily PX domain 4.71e-23
Family PX domain 0.0013
Further Details:      
 
Domain Number 2 Region: 450-556,620-655
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.26e-18
Family YiiX-like 0.017
Further Details:      
 
Domain Number 3 Region: 109-150
Classification Level Classification E-value
Superfamily PH domain-like 0.0000148
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  PYU1_T006234
Domain Number - Region: 8-81,114-145
Classification Level Classification E-value
Superfamily PH domain-like 0.00646
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006234
Sequence length 694
Comment protein Name="PYU1_T006234" Note="Similar to SNX17: Sorting nexin-17 (Bos taurus)" AED:0.431311403418013 QI:0|0.2|0|0.66|1|1|6|0|694
Sequence
MALALANCLHQGKLRQFSAQYGGWLAINVALFGHALVMDPDGDAPRAAVTPRKRRNSVKA
MWMELFAVASIVSVRKEDKPWSIDMDDSPALSPPAAARRSRRSSASEFISMGFGFTVVTT
NPDQTFQFEAATEIEREEWIRCLLLARKLLGASASAQLSSDDPDAFYRFASSDSEDSNES
DAEDDAASSKSDAKARGEPSLRSAQPLTNPHHTPIVKVNPGKHKAISLTILHITATNAAG
ERLEVTIPLSESSQEEISVKQIKLDAIQQLRNQLHHAHSDRWLSNEQRAIGYYISGIPAR
SIHLALLPVNTMPHPTIEVAIAATKNKVSDLSQKTYTTYTIDVSFSDVKWQLARRYKEFD
ALHAHLEDKYGHAPLPILPSKRLFTPLEGTFVDKRREQLENYLKQMVLHPLVGSDVLFLS
FLGVVNTSRDRELSNNEKNVLHVTTLHQSLDCGDILLFSCRFGASVLQRKFTGAKYDHVG
IVVPGASRNLLRIMEATSEGIQVYSLKARLMAYSREVSNVIAVRRIRAERTPEMVEQLRL
FVERVEGNPYSILGILRSKGESERMVLATSTKSQSQATISSSGHSSDSDSSGSSGGSIAS
APVSPAHQASSSFTADSKTKKRKYFCSSLAASTLKHVGWIHTHHSSSHFWPGSFEDGGEV
EQYLANGVMMEPEAVIDCRIVEVGLATQEPKPTL
Download sequence
Identical sequences K3WMP2
PYU1_T006234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]