SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006241 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006241
Domain Number 1 Region: 19-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000176
Family DIX domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006241
Sequence length 286
Comment protein Name="PYU1_T006241" Note="Similar to Sfrs15: Splicing factor, arginine/serine-rich 15 (Fragment) (Rattus norvegicus)" AED:0.0816326530612245 QI:0|0.8|0.5|1|1|1|6|0|286
Sequence
MEGMLNYFIPEDGDSSDHLNVVPLPRVEQLKLQHVKKVFPLPGQFHFRFKTPFEGTYVWL
DVVNDSDAIPDFNGLVISKIARVQSESSTRPVERVAANTAPANAPDLIQTSHEPESVKRE
DVPATPKAFNDDLVGLLSDPVPATAAPVSTSSAPPTPPPQAKPVPQDPFNLFMGSPSVQS
SPMRPMPSPMNAARGPPGSNPGPGAFGGNPGGFNPMGGAPRPGGSMGISQMHMGMNQVPN
PHQQQQQQAANSFQGLQWGGMGTGPQQQQQQQQRNPMQQNPNNRQW
Download sequence
Identical sequences K3WMP9
PYU1_T006241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]