SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006278 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006278
Domain Number 1 Region: 185-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000944
Family Ubiquitin-related 0.0078
Further Details:      
 
Domain Number 2 Region: 273-347
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000414
Family Ubiquitin-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006278
Sequence length 374
Comment protein Name="PYU1_T006278" Note="Similar to SMT3: Ubiquitin-like protein SMT3 (Arabidopsis thaliana)" AED:0.332390423572744 QI:0|0.16|0|0.28|1|1|7|0|374
Sequence
MSSDEGDTPVKLYNPLERNRKRQHFVSIDSSSSEEDESSVYEESPLVPKRRRSLRSSRRS
SMSPSVAARTDGDDEGEEKVETLEDLMTDAEREAARQSELQIEREIAQRIAQDEVLNKTR
EIMNKISSAQRQRNHDSGLTEVISLDSDDDDDDDDFQIISQPVKPGAAKGASRLESSRQS
YQQAPADKGERIVLQIRANGERTDEVPIHMNEPFDVLYKNFCDLLGLPRTAVKMSLDGDA
LPVSSTPSALDLESGDLIDAKVDFSQQNTADIKTFVRLKLIVQGKRPEIFKIDVNSTLEK
LHSGFCKKHNIVFSEDVVLSALGVTLRLNQTIESYGLRDDDEIQVEIENVVDPSAIALQL
RFSDGTTETHHVIP
Download sequence
Identical sequences K3WMT6
PYU1_T006278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]