SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006306 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006306
Domain Number 1 Region: 3-95,263-339
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.48e-33
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 2 Region: 352-471
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-25
Family Canonical RBD 0.0033
Further Details:      
 
Domain Number 3 Region: 590-613,641-689
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000557
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006306
Sequence length 897
Comment protein Name="PYU1_T006306" Note="Similar to Rbm28: RNA-binding protein 28 (Mus musculus)" AED:0.18872870643472 QI:0|0|0|0.5|1|1|4|0|897
Sequence
MSSSVFVRNLPYGITQEELEQVFSDIGPVKKVDVIKDKGKKKSDMLTRGFAFVKFAIEND
AVYAVEKLNGHELQGRRMRLEIAREKGKRNENASAQPRQPQQQQKEEEVASVAKAEAEVY
IPLENKDEDVKPKKEKKEKKEKKEKKEKKEKKNKEAAEVKEEETVKTEDEAPKKDKKKKG
KKVKEEAEPEPVEEVKQEKPKKKAAPASTQKTSAAAADKPNFAATTTKVNEDGHVQSERN
ARRRMHREFLRQVEQRKNDEASIEQKSVVIYGLGAEVTQKHIAKKVKKIGKAVKIELKEE
DKTQKKFAVVQFEKLADASTAIKKLDHHIFKGAMLKVKCLASGANDAKENEGLRLIVRNL
AFQTTDSDLEKAFEVHGPLFEARVVRMPVEDPDNAASDAVGRSRGFGFVQFRDINDARQA
IEKLNDGLKAFFSTFGAVEYARIVYDYGSGLSKGVAFVRFKDSTVADRVLARGQLAADRE
DQKKSKKGKTKKENLFTLSALADGDALMLDGRMLSLTRAVGKEDADRLTTENSNERKKKD
KRNMYLAYEGTINVNKLSDEELMLPKMDIDKRRRAIREKKEKLKNPMYFVSPVRLSVRNI
SSSVDDKKLKEIFRDGAIAGLREKNVDRSEVKLELLPKNDAVPVKVKMAKIVRDTEMAKA
GKEARSRGYGFVEFAEHTHALAALRKINNNPAFTHYAAGAKTDKKGGALEESEKSRLIVE
FALENHGKLKLREKRKQDAEKRREEEKALREAQGEGAETAAIEKKSRGQRQREAKKARAL
EKSEKATEGADGEKAVKKPKKEVIVASKVPNQKRKRTDVDEVASSLPSGSVTKAEKKKKN
KKVKTESRKDRKQAKEIEQEESFDALVRNYKREIFGEKPVAARNDDAQEQPRERWFD
Download sequence
Identical sequences K3WMW4
PYU1_T006306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]