SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006348 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006348
Domain Number 1 Region: 509-578
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000155
Family PHD domain 0.0068
Further Details:      
 
Weak hits

Sequence:  PYU1_T006348
Domain Number - Region: 372-432
Classification Level Classification E-value
Superfamily RING/U-box 0.0212
Family RING finger domain, C3HC4 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006348
Sequence length 627
Comment protein Name="PYU1_T006348" Note="Similar to Whsc1l1: Histone-lysine N-methyltransferase NSD3 (Mus musculus)" AED:0.284782441869388 QI:0|0|0|0.57|1|1|7|0|627
Sequence
MAMGFRGVLLKLAEAEAESLKLFRVVAPDAQLALTLSTAAASHNALRGSQQNESLALAAD
ETLLVTDVVSSRVLQVARCGSVSLQRETNSALWVAALPRQKTPLPQDHAGSGYVQQQQQP
SATMVKRPMIAPWDPMIGHQIHGGTAQVTRICYCFQFRSSVEYEMFERTVHAYLRIQRMA
LLEKSVLMEVEIQYELDGAKKTKKKDVKDGIMHGDRNKVTPSPHNRALVSREQLHGSMNT
SRPMSRTQGNAMSRSVQRNRTVSNVRSTAGQQVLRDLVTPTRGGGTLNRTAGASGGARGT
SKVARAVLLDPNTICILCKTKQAQSIKQLSKHPFVLQDTKGHEVYICMVCMEQVLRRRVK
HQGTLVLGAPVAVCGLCSETETSLGHALKKCAHPQCPCSYCTACLHKLVGKARTQSVWRT
REWHCPNCTPFNTENSKAVRSNGPPSLTPGASSAATRSEVDDKIKRNRKRRLEITDENDS
SQSVASPNEMVMASVDYAANYFQFLMNREHSKVPPEDESEDVCFCCKDGGELIECDWPGD
DLKGAKCPKVYHEECLGYKVPENFLWKCPRHRCQTCGIIAKSSCRFCVTSYCADHVPEGV
KRAVAQGTLAAKTHALIFRSPPKRVVK
Download sequence
Identical sequences K3WN06
PYU1_T006348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]