SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006364 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006364
Domain Number 1 Region: 11-246,363-392
Classification Level Classification E-value
Superfamily DNase I-like 3.66e-28
Family Sphingomyelin phosphodiesterase-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006364
Sequence length 403
Comment protein Name="PYU1_T006364" Note="Similar to At1g02270: Uncharacterized calcium-binding protein At1g02270 (Arabidopsis thaliana)" AED:0.0532095244922722 QI:0|1|0.5|1|1|1|4|0|403
Sequence
MLELVRRRAVPRTLSLMTFNVLAPCYFRHGGRVESDDRTAFLSRAQALIHAIQRERCDLV
CLQEYWFNREYQATFRRAFYPSHYIHTLKRPGDKEDGLAIFVEKNKFEIHHVQHIDFEAD
QAGDRVALLMHVATKWNRHDVPLAQRSFLVINSHLTFPHCQMYKDMRLDQIKVVLESVRD
YVTRESLENVPVLMCGDFNDFNDPVHSLVMQNGYASVFAYLHGREAKITHCNHNNREVGV
DFVFASHVQGANSSSSSTSSVLTTRRRASELIVESPDPTGTGRSTMHAVIEEEEEVRAVD
PRKTSTSLIDTSLQLVPRTCHLSPRNLTDETRLKRPRFGHDWRKVQPPLQHDDNIESDES
QQQQLYDESALVDYWRMVSDHRPLVATFDVLSPSPTVSRLILP
Download sequence
Identical sequences K3WN22
PYU1_T006364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]