SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006454 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006454
Domain Number 1 Region: 5-53
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000217
Family Myb/SANT domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006454
Sequence length 215
Comment protein Name="PYU1_T006454" Note="Similar to mybI: Myb-like protein I (Dictyostelium discoideum)" AED:0.277551020408163 QI:88|-1|0|1|-1|1|1|2|215
Sequence
MSGEGVWSQEEHDLFLEALQLYPQGPWKSITEHVGTRSVRQVQTHAQKYHEKVARRLRGL
RKERKRLLRPEHRIDDEMMDLCREVENGRLSVASSASSSTSGTPHTSSIWCHHERSSEAG
NECSHSWHSHSSHSGFQEYEYLHPQRQHNGGQGRPGHPFDCTHVAEEFAGTDSTVSPRRH
GDMPSFSDCMDFLIDFFGSRQINDTTWYRQHQRRR
Download sequence
Identical sequences K3WNB2
PYU1_T006454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]