SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006467 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006467
Domain Number 1 Region: 24-73
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000598
Family Myb/SANT domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006467
Sequence length 183
Comment protein Name="PYU1_T006467" Note="Similar to mybJ: Myb-like protein J (Dictyostelium discoideum)" AED:0.0869565217391304 QI:0|-1|0|1|-1|1|1|0|183
Sequence
MSSSATESIAKRESSSGGAHRIEQGVWSKDEHDKFLATLKMYPHGPWKLIAERIGTRSPR
QVQTHAQKYYEKVARRVRGLRKNRKNLARPEHRIDDELATLCKKNIIDRSHAQVTPESKS
QPLAACAVVTMTPPPPLASVGQTQSLRYRNEAHDHNCGNMCYKCLLLQVEASTYHRNEWA
RST
Download sequence
Identical sequences K3WNC5
PYU1_T006467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]