SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006469 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T006469
Domain Number - Region: 1-33
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000139
Family Myb/SANT domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006469
Sequence length 174
Comment protein Name="PYU1_T006469" Note="Protein of unknown function" AED:0.152777777777778 QI:0|-1|0|1|-1|1|1|0|174
Sequence
MYPEGPWKLIAERVGTRSARQVQTHAQKYYEKVARRLRGLRKDRKKLVRPEHRLDEDMEK
LCKVAVCEENKVPTGPIRRGLSPVLVQPPVSSPSAVDAKTEDIDSSTLHSRERANSCAGS
IASQGTEELNDSNCESEEICANDVADSDDPDALSDFDDYCLDYLIDILGPSVWV
Download sequence
Identical sequences K3WNC7
PYU1_T006469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]