SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006472 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006472
Domain Number 1 Region: 17-68
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000202
Family Myb/SANT domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006472
Sequence length 200
Comment protein Name="PYU1_T006472" Note="Similar to mybJ: Myb-like protein J (Dictyostelium discoideum)" AED:0.0174129353233831 QI:0|-1|0|1|-1|1|1|0|200
Sequence
MSTTSIQASKSKTMPTARLWSEDEHDRFLVGLKKFPRGPWRMIAAQVGTRTPRQVQTHAQ
KYYEKINRRLRGLRKDRKNVVRSEHRLDEDMEHLCQIVDNGAEDSRIGLFLGRGLSALVT
ASAIASNAPECVSTKQSDLSRSHASGSDFIVPSDVLDANDATGTASLVDLDDAFLGYLLE
VLECASECTSDDNGSEFDLE
Download sequence
Identical sequences K3WND0
PYU1_T006472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]